Project name: 1jy9

Status: done

submitted: 2025-12-12 13:31:48, status changed: 2025-12-12 17:16:11

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence TTTTRYVEVPGKKILQTTTT
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEEEECCCEEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 36.8896 4.25594 23.7365 157
cluster_2.pdb ( medoid) 16.3947 7.80738 32.0758 128
cluster_3.pdb ( medoid) 13.3162 5.10656 22.3722 68
cluster_4.pdb ( medoid) 12.7961 10.1593 31.483 130
cluster_5.pdb ( medoid) 9.30287 14.4042 35.4506 134
cluster_6.pdb ( medoid) 7.66499 12.9159 28.1937 99
cluster_7.pdb ( medoid) 6.999 9.28703 35.3049 65
cluster_8.pdb ( medoid) 5.87491 11.7449 27.8922 69
cluster_9.pdb ( medoid) 5.15741 19.3896 36.679 100
cluster_10.pdb ( medoid) 3.51081 14.2417 32.0273 50