CABS-dock: 1jy9

Project name: 1jy9

Status: done

submitted: 2025-12-12 13:31:48, status changed: 2025-12-12 17:16:11

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	TTTTRYVEVPGKKILQTTTT
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEEECCCEEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	36.8896	4.25594	23.7365	157
cluster_2.pdb ( medoid)	16.3947	7.80738	32.0758	128
cluster_3.pdb ( medoid)	13.3162	5.10656	22.3722	68
cluster_4.pdb ( medoid)	12.7961	10.1593	31.483	130
cluster_5.pdb ( medoid)	9.30287	14.4042	35.4506	134
cluster_6.pdb ( medoid)	7.66499	12.9159	28.1937	99
cluster_7.pdb ( medoid)	6.999	9.28703	35.3049	65
cluster_8.pdb ( medoid)	5.87491	11.7449	27.8922	69
cluster_9.pdb ( medoid)	5.15741	19.3896	36.679	100
cluster_10.pdb ( medoid)	3.51081	14.2417	32.0273	50