Project name: KIR_JAK2

Status: done

submitted: 2026-04-30 19:04:25, status changed: 2026-05-01 05:55:25

Project settings
Protein sequence(s) AHFEKRFLKRIRDLGEGHFGKVELCRYGDNTGEQVAVKSLKPHIADLKKEIEILRNLYHENIVKYKGICTEGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALL input pdb
Peptide sequence GDTHFRTFRSHADYRR
Simulation mc cycles100
Peptide secondary structure psipred CCCCCCCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.53 5.6796 28.9946 145
cluster_2.pdb ( medoid) 22.905 6.67976 23.0332 153
cluster_3.pdb ( medoid) 18.9381 4.3299 11.7768 82
cluster_4.pdb ( medoid) 16.2658 9.7751 28.3853 159
cluster_5.pdb ( medoid) 15.9162 6.34572 18.9569 101
cluster_6.pdb ( medoid) 6.66182 10.3575 24.796 69
cluster_7.pdb ( medoid) 6.66133 17.4139 43.1318 116
cluster_8.pdb ( medoid) 6.45673 11.1512 37.5736 72
cluster_9.pdb ( medoid) 3.56693 19.3444 42.1536 69
cluster_10.pdb ( medoid) 1.73052 19.6473 38.4404 34