CABS-dock: P32CC

Project name: P32CC

Status: done

submitted: 2025-12-22 15:14:06, status changed: 2025-12-23 02:29:11

Project settings

Protein sequence(s)	SKHRIEPVCLIIRGSPGTGKSLATGIIARAIADKYHSSVYSLPPDPDHFDGYKQQVVTVMDDLCQNPDGKDMSLFCQMVSTVDFIPPMASLEEKGVSFTSKFVIASTNASNIIVPTVSDSDAIRRRFYMDCDIEVTDSYKTELGRLDAGRAAKLCSENNTANFKRCSPLVCGKAIQLRDRKSKVRYSVDTVVSELIREYNSRSAIGNTIEALFQ input pdb
Peptide sequence	KQCRQELSPRNR
Simulation mc cycles	100
Peptide secondary structure psipred	CCHHHHCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	37.9305	8.35739	36.7162	317
cluster_2.pdb ( medoid)	31.8118	3.61501	15.184	115
cluster_3.pdb ( medoid)	25.8969	2.20104	7.00083	57
cluster_4.pdb ( medoid)	21.5389	2.46067	12.0969	53
cluster_5.pdb ( medoid)	20.7639	2.26354	7.96255	47
cluster_6.pdb ( medoid)	14.9805	10.8808	29.8035	163
cluster_7.pdb ( medoid)	12.2251	4.66254	24.0989	57
cluster_8.pdb ( medoid)	8.05055	14.2847	36.1229	115
cluster_9.pdb ( medoid)	3.90159	11.7901	30.5469	46
cluster_10.pdb ( medoid)	2.22557	13.4797	23.8768	30