CABS-dock: 68637091af78dc5

Project name: 68637091af78dc5

Status: done

submitted: 2026-04-10 04:21:32, status changed: 2026-04-10 09:51:40

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RRRVQLYPGSNDARRRH
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCHHHCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	65.9613	1.54636	16.1822	102
cluster_2.pdb ( medoid)	30.0949	3.32282	7.71976	100
cluster_3.pdb ( medoid)	29.9244	3.44201	14.4357	103
cluster_4.pdb ( medoid)	10.6409	9.02177	22.811	96
cluster_5.pdb ( medoid)	8.94937	9.2744	18.8531	83
cluster_6.pdb ( medoid)	5.76023	13.7147	27.4744	79
cluster_7.pdb ( medoid)	5.47057	12.4301	25.6572	68
cluster_8.pdb ( medoid)	4.80009	14.1664	29.8254	68
cluster_9.pdb ( medoid)	4.59856	9.78567	22.5581	45
cluster_10.pdb ( medoid)	3.88526	14.4135	33.4308	56