Project name: 68637091af78dc5

Status: done

submitted: 2026-04-10 04:21:32, status changed: 2026-04-10 09:51:40

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence RRRVQLYPGSNDARRRH
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCCCHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 65.9613 1.54636 16.1822 102
cluster_2.pdb ( medoid) 30.0949 3.32282 7.71976 100
cluster_3.pdb ( medoid) 29.9244 3.44201 14.4357 103
cluster_4.pdb ( medoid) 10.6409 9.02177 22.811 96
cluster_5.pdb ( medoid) 8.94937 9.2744 18.8531 83
cluster_6.pdb ( medoid) 5.76023 13.7147 27.4744 79
cluster_7.pdb ( medoid) 5.47057 12.4301 25.6572 68
cluster_8.pdb ( medoid) 4.80009 14.1664 29.8254 68
cluster_9.pdb ( medoid) 4.59856 9.78567 22.5581 45
cluster_10.pdb ( medoid) 3.88526 14.4135 33.4308 56