Project name: 68c1d6529331f3

Status: done

submitted: 2026-03-08 14:24:47, status changed: 2026-03-09 02:11:30

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence VQLFGSNCW
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 23.4192 5.84991 24.0856 137
cluster_2.pdb ( medoid) 20.6636 6.72681 33.7972 139
cluster_3.pdb ( medoid) 14.8824 9.81022 30.2997 146
cluster_4.pdb ( medoid) 12.6756 11.2815 52.6749 143
cluster_5.pdb ( medoid) 11.5396 12.3921 38.0633 143
cluster_6.pdb ( medoid) 7.65459 14.7624 30.9682 113
cluster_7.pdb ( medoid) 3.80071 19.4701 49.0852 74
cluster_8.pdb ( medoid) 3.08576 15.5553 35.3742 48
cluster_9.pdb ( medoid) 1.97017 15.7346 33.065 31
cluster_10.pdb ( medoid) 1.72727 15.0527 28.9321 26