CABS-dock: 1ma4

Project name: 1ma4

Status: done

submitted: 2025-12-12 13:54:49, status changed: 2025-12-12 15:32:09

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	KWYFRVYYRGIYYRRYR
Simulation mc cycles	50
Peptide secondary structure psipred	CCEEEEEEEEEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.6304	8.25977	27.621	253
cluster_2.pdb ( medoid)	25.1413	4.89236	30.6086	123
cluster_3.pdb ( medoid)	21.037	5.70423	28.9376	120
cluster_4.pdb ( medoid)	18.8483	2.44054	25.2703	46
cluster_5.pdb ( medoid)	13.5344	10.344	28.5333	140
cluster_6.pdb ( medoid)	13.1583	5.24382	20.104	69
cluster_7.pdb ( medoid)	13.093	9.31798	25.7225	122
cluster_8.pdb ( medoid)	3.40942	10.8523	24.8788	37
cluster_9.pdb ( medoid)	3.35123	18.2023	32.4812	61
cluster_10.pdb ( medoid)	2.67119	10.8566	26.2882	29