Project name: 1ma4

Status: done

submitted: 2025-12-12 13:54:49, status changed: 2025-12-12 15:32:09

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence KWYFRVYYRGIYYRRYR
Simulation mc cycles50
Peptide secondary structure psipred CCEEEEEEEEEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.6304 8.25977 27.621 253
cluster_2.pdb ( medoid) 25.1413 4.89236 30.6086 123
cluster_3.pdb ( medoid) 21.037 5.70423 28.9376 120
cluster_4.pdb ( medoid) 18.8483 2.44054 25.2703 46
cluster_5.pdb ( medoid) 13.5344 10.344 28.5333 140
cluster_6.pdb ( medoid) 13.1583 5.24382 20.104 69
cluster_7.pdb ( medoid) 13.093 9.31798 25.7225 122
cluster_8.pdb ( medoid) 3.40942 10.8523 24.8788 37
cluster_9.pdb ( medoid) 3.35123 18.2023 32.4812 61
cluster_10.pdb ( medoid) 2.67119 10.8566 26.2882 29