Project name: 68f976ae648ebf7

Status: done

submitted: 2025-12-29 11:01:59, status changed: 2025-12-29 14:37:54

Project settings
Protein sequence(s) MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATRRVIVFVQCGSNCRMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence LPPTDESIKYTIYNSTGIQIGAYNYMEIGG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCEEEECCCCEEECCCCEECCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 38.1783 2.88122 25.325 110
cluster_2.pdb ( medoid) 27.2823 3.812 18.246 104
cluster_3.pdb ( medoid) 26.1024 4.06093 12.8699 106
cluster_4.pdb ( medoid) 18.6011 6.02116 30.0545 112
cluster_5.pdb ( medoid) 12.2588 9.70731 27.9818 119
cluster_6.pdb ( medoid) 11.2153 11.6805 30.7007 131
cluster_7.pdb ( medoid) 9.32078 12.0162 25.1755 112
cluster_8.pdb ( medoid) 6.35531 15.8922 31.3498 101
cluster_9.pdb ( medoid) 5.70589 14.3711 28.8347 82
cluster_10.pdb ( medoid) 1.42442 16.1469 28.8748 23