CABS-dock: 8TBP_EMGFKH

Project name: 8TBP_EMGFKH_E2

Status: done

submitted: 2026-05-30 16:15:46, status changed: 2026-05-31 08:33:34

Project settings

Protein sequence(s)	DTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA input pdb
Peptide sequence	EMGFKHINHQVVPTLAVSKNKAL
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCCCCCCCCEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	38.5707	3.11117	19.6497	120
cluster_2.pdb ( medoid)	19.5129	3.33114	14.0423	65
cluster_3.pdb ( medoid)	15.1446	7.98964	16.8403	121
cluster_4.pdb ( medoid)	14.728	9.16624	26.7854	135
cluster_5.pdb ( medoid)	13.5349	9.82642	24.1373	133
cluster_6.pdb ( medoid)	11.7037	11.6203	43.585	136
cluster_7.pdb ( medoid)	10.1032	8.71011	22.2571	88
cluster_8.pdb ( medoid)	8.70318	13.0987	24.7364	114
cluster_9.pdb ( medoid)	5.01875	9.36488	27.2822	47
cluster_10.pdb ( medoid)	3.78577	10.83	20.9166	41