Project name: JSLEE_27

Status: done

submitted: 2023-11-28 23:58:40, status changed: 2023-11-29 01:28:44

Project settings
Protein sequence(s) SRRNAWGNQSYAELISQAIESAPEKRLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWMLNPEGG input pdb
Peptide sequence DLMLSPDDIEQWFTED
Simulation mc cycles50
Peptide secondary structure CCCCCCCCCCCCCCCC
Flexible regions
92:A - 99:A
Unlikely to bind regions
159:A - 181:A
Contact information
150:A 5:PEP 10.0 1.0
126:A 12:PEP 6.0 1.0
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 45.1871 6.41777 14.9939 290
cluster_2.pdb ( medoid) 29.5992 3.95281 11.3453 117
cluster_3.pdb ( medoid) 29.1556 3.60137 20.0673 105
cluster_4.pdb ( medoid) 19.9291 5.72028 13.2018 114
cluster_5.pdb ( medoid) 12.2011 9.42536 23.5702 115
cluster_6.pdb ( medoid) 10.8926 5.50833 16.647 60
cluster_7.pdb ( medoid) 9.6075 6.66146 20.2314 64
cluster_8.pdb ( medoid) 7.85244 5.22131 12.0485 41
cluster_9.pdb ( medoid) 6.35075 8.66039 17.5668 55
cluster_10.pdb ( medoid) 6.02907 6.46866 17.4466 39