Project name: 693a8fa9e101b61

Status: done

submitted: 2026-03-12 08:36:55, status changed: 2026-03-12 12:09:53

Project settings
Protein sequence(s) APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence KWRKGSVQLFGSNDA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.7457 5.51834 27.0797 120
cluster_2.pdb ( medoid) 18.127 10.8126 44.7141 196
cluster_3.pdb ( medoid) 15.3395 7.56219 40.5822 116
cluster_4.pdb ( medoid) 8.6343 10.1919 29.4253 88
cluster_5.pdb ( medoid) 7.15546 13.4163 34.3015 96
cluster_6.pdb ( medoid) 7.10634 15.4791 35.2908 110
cluster_7.pdb ( medoid) 7.02197 11.9625 37.4079 84
cluster_8.pdb ( medoid) 6.43084 10.8851 29.4404 70
cluster_9.pdb ( medoid) 6.19202 11.4664 38.0017 71
cluster_10.pdb ( medoid) 3.34527 14.6475 30.4049 49