CABS-dock: 698005def96e072

Project name: 698005def96e072

Status: done

submitted: 2025-12-30 15:24:10, status changed: 2025-12-30 17:48:40

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	RVIVQCGSNSFR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEECCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	43.618	3.27846	21.1962	143
cluster_2.pdb ( medoid)	24.3943	7.91167	24.0065	193
cluster_3.pdb ( medoid)	17.4434	6.19145	21.598	108
cluster_4.pdb ( medoid)	16.5974	8.61581	36.6472	143
cluster_5.pdb ( medoid)	12.8949	5.04075	15.6507	65
cluster_6.pdb ( medoid)	9.20336	10.7569	31.4209	99
cluster_7.pdb ( medoid)	8.46975	6.61176	22.7565	56
cluster_8.pdb ( medoid)	5.0177	10.164	22.3547	51
cluster_9.pdb ( medoid)	4.58329	17.2365	35.3044	79
cluster_10.pdb ( medoid)	4.56332	13.8057	27.8708	63