CABS-dock: 69a6832acd3931e

Project name: 69a6832acd3931e

Status: done

submitted: 2026-03-12 06:28:11, status changed: 2026-03-12 09:56:11

Project settings

Protein sequence(s)	APYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE input pdb
Peptide sequence	RRMKWKVQLFGSNDAKK
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCEEEECCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.1749	3.74483	18.3901	113
cluster_2.pdb ( medoid)	24.6186	5.32118	29.8871	131
cluster_3.pdb ( medoid)	17.8369	7.90497	27.4797	141
cluster_4.pdb ( medoid)	14.4767	7.32211	23.4432	106
cluster_5.pdb ( medoid)	10.6005	9.43348	23.3778	100
cluster_6.pdb ( medoid)	9.8849	13.6572	29.0013	135
cluster_7.pdb ( medoid)	7.68917	15.4763	29.5554	119
cluster_8.pdb ( medoid)	6.81274	13.9445	33.0412	95
cluster_9.pdb ( medoid)	3.72086	11.2877	27.0159	42
cluster_10.pdb ( medoid)	1.20281	14.9649	28.9573	18