Project name: 6a801fa029c46eb

Status: done

submitted: 2026-01-12 06:02:25, status changed: 2026-01-12 11:19:17

Project settings
Protein sequence(s) MLILKGTKTVDLSKDELTEIIGQFDRVHIDLGTGDGRNIYKLAINDQNTFYIGIDPVKENLFDISKKIIKKPSKGGLSSNVVFVIAAAESSLPFELKNIADSIISILFPWGTLLEYVIKPNRRDILSSNVADLAKKEAHFEFVTTYSDSYEEAEIKKRGLPLLSKAYFLSEQYKAELSNSGFRRIDDVKELDNEYVKQFNSLWAKRLAFGRKRSFFRVSGHVSKH input pdb
Peptide sequence KENLFDISKKII
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHCHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 32.5551 1.9659 10.5282 64
cluster_2.pdb ( medoid) 23.1209 5.92539 11.0321 137
cluster_3.pdb ( medoid) 18.7636 9.37987 37.0616 176
cluster_4.pdb ( medoid) 15.8738 3.33883 10.018 53
cluster_5.pdb ( medoid) 14.8485 10.6408 35.6709 158
cluster_6.pdb ( medoid) 14.4327 6.513 17.386 94
cluster_7.pdb ( medoid) 14.0606 8.67673 20.8613 122
cluster_8.pdb ( medoid) 13.0876 6.95313 17.5517 91
cluster_9.pdb ( medoid) 8.02843 5.97875 14.3891 48
cluster_10.pdb ( medoid) 6.21639 9.16931 17.2723 57