CABS-dock: 6ad7db6adb12e22

Project name: 6ad7db6adb12e22

Status: done

submitted: 2025-12-13 22:58:35, status changed: 2025-12-14 02:46:29

Project settings

Protein sequence(s)	GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRWFLNKDLEVDGHFVTMQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRD input pdb
Peptide sequence	YLYNTGRSV
Simulation mc cycles	10
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	70.4765	1.41891	4.35581	100
cluster_2.pdb ( medoid)	24.4564	6.25603	38.2716	153
cluster_3.pdb ( medoid)	13.8722	12.1105	41.0691	168
cluster_4.pdb ( medoid)	13.3914	7.76617	25.697	104
cluster_5.pdb ( medoid)	13.0058	8.22709	35.3775	107
cluster_6.pdb ( medoid)	11.1525	12.8222	39.0846	143
cluster_7.pdb ( medoid)	9.16137	6.33093	16.0936	58
cluster_8.pdb ( medoid)	6.84062	14.0338	37.1826	96
cluster_9.pdb ( medoid)	4.34474	9.66686	17.1772	42
cluster_10.pdb ( medoid)	2.93506	9.88056	20.009	29