CABS-dock: SMC-II- hMPV-F

Project name: SMC-II- hMPV-F

Status: done

submitted: 2025-06-21 17:50:09, status changed: 2025-06-21 20:15:31

Project settings

Protein sequence(s)	MPTSAGQIKLMLENRAMVRRKGFGILIGVYGSSVIYMVQLPIFGVIDTPCWIVKAAPSCSEKKGNYACLLREDQGWYCQNAGSTVYYPNEKDCETRGDHVFCDTAAGINVAEQSKECNINISTTNYPCKV input pdb
Peptide sequence	CLGIGSCNDFAGCGYAIVCFW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCEEEEEEC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	31.0426	7.0226	25.1933	218
cluster_2.pdb ( medoid)	30.0644	6.45281	29.4025	194
cluster_3.pdb ( medoid)	12.7123	8.25971	26.179	105
cluster_4.pdb ( medoid)	10.2208	4.59845	15.6555	47
cluster_5.pdb ( medoid)	6.83227	11.27	26.9676	77
cluster_6.pdb ( medoid)	6.7239	10.1132	35.559	68
cluster_7.pdb ( medoid)	6.65288	15.6323	30.3643	104
cluster_8.pdb ( medoid)	5.87352	13.4502	24.1736	79
cluster_9.pdb ( medoid)	5.72094	11.3618	22.62	65
cluster_10.pdb ( medoid)	3.29612	13.0456	29.1604	43