CABS-dock: 6b25f21704b1330

Project name: 6b25f21704b1330

Status: done

submitted: 2025-12-28 18:15:08, status changed: 2025-12-28 20:56:26

Project settings

Protein sequence(s)	MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence	NPVTGRPLVNIYNCSGVQVGDNNYLTMQQT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCEEEEECCCCCEECCCCEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	52.6075	0.969444	1.97402	51
cluster_2.pdb ( medoid)	30.9529	3.26302	19.8516	101
cluster_3.pdb ( medoid)	20.3815	9.96004	31.8807	203
cluster_4.pdb ( medoid)	16.7827	6.25644	25.4402	105
cluster_5.pdb ( medoid)	10.6678	13.9673	32.1108	149
cluster_6.pdb ( medoid)	8.53766	13.0012	28.2735	111
cluster_7.pdb ( medoid)	8.46846	7.91171	24.9497	67
cluster_8.pdb ( medoid)	7.06435	10.7582	28.3696	76
cluster_9.pdb ( medoid)	6.88155	11.6253	23.0525	80
cluster_10.pdb ( medoid)	4.37836	13.0186	27.1113	57