Project name: 6b25f21704b1330

Status: done

submitted: 2025-12-28 18:15:08, status changed: 2025-12-28 20:56:26

Project settings
Protein sequence(s) MVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPAMVLSDKTPGSASYRISDNNFVQCGSNCTMIIDGDVVRGRPQDPGAAASPA input pdb
Peptide sequence NPVTGRPLVNIYNCSGVQVGDNNYLTMQQT
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCEEEEECCCCCEECCCCEEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 52.6075 0.969444 1.97402 51
cluster_2.pdb ( medoid) 30.9529 3.26302 19.8516 101
cluster_3.pdb ( medoid) 20.3815 9.96004 31.8807 203
cluster_4.pdb ( medoid) 16.7827 6.25644 25.4402 105
cluster_5.pdb ( medoid) 10.6678 13.9673 32.1108 149
cluster_6.pdb ( medoid) 8.53766 13.0012 28.2735 111
cluster_7.pdb ( medoid) 8.46846 7.91171 24.9497 67
cluster_8.pdb ( medoid) 7.06435 10.7582 28.3696 76
cluster_9.pdb ( medoid) 6.88155 11.6253 23.0525 80
cluster_10.pdb ( medoid) 4.37836 13.0186 27.1113 57