CABS-dock: 6baf282582885e6

Project name: 6baf282582885e6

Status: done

submitted: 2026-02-19 03:51:53, status changed: 2026-02-19 06:18:10

Project settings

Protein sequence(s)	VVAAAEKTKQGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKK input pdb
Peptide sequence	GLPTCGETCTLGTCYVPDCSCSWPICMKN
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCEEECCEECCCCCEEECEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	15.7515	7.99925	40.3345	126
cluster_2.pdb ( medoid)	13.5159	8.80442	26.8623	119
cluster_3.pdb ( medoid)	12.7362	11.6205	32.1869	148
cluster_4.pdb ( medoid)	7.08082	10.8744	29.1754	77
cluster_5.pdb ( medoid)	6.71539	14.4444	36.6841	97
cluster_6.pdb ( medoid)	6.5969	13.9459	48.2664	92
cluster_7.pdb ( medoid)	6.4925	15.8645	50.7535	103
cluster_8.pdb ( medoid)	6.04631	16.7044	39.4604	101
cluster_9.pdb ( medoid)	4.30851	17.1753	48.4064	74
cluster_10.pdb ( medoid)	4.12372	15.2775	38.9067	63