Project name: 6baf282582885e6

Status: done

submitted: 2026-02-19 03:51:53, status changed: 2026-02-19 06:18:10

Project settings
Protein sequence(s) VVAAAEKTKQGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKK input pdb
Peptide sequence GLPTCGETCTLGTCYVPDCSCSWPICMKN
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCEEECCEECCCCCEEECEEEECC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 15.7515 7.99925 40.3345 126
cluster_2.pdb ( medoid) 13.5159 8.80442 26.8623 119
cluster_3.pdb ( medoid) 12.7362 11.6205 32.1869 148
cluster_4.pdb ( medoid) 7.08082 10.8744 29.1754 77
cluster_5.pdb ( medoid) 6.71539 14.4444 36.6841 97
cluster_6.pdb ( medoid) 6.5969 13.9459 48.2664 92
cluster_7.pdb ( medoid) 6.4925 15.8645 50.7535 103
cluster_8.pdb ( medoid) 6.04631 16.7044 39.4604 101
cluster_9.pdb ( medoid) 4.30851 17.1753 48.4064 74
cluster_10.pdb ( medoid) 4.12372 15.2775 38.9067 63