CABS-dock: 6c002fe991a6f9c

Project name: 6c002fe991a6f9c

Status: done

submitted: 2026-01-21 15:02:25, status changed: 2026-01-22 01:40:33

Project settings

Protein sequence(s)	VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS input pdb
Peptide sequence	VDPREGKTSSSFRAHESHKA
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCHHCCCCHHCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	26.6336	4.9186	29.0007	131
cluster_2.pdb ( medoid)	22.6285	5.25885	31.1147	119
cluster_3.pdb ( medoid)	19.3736	5.83267	27.8521	113
cluster_4.pdb ( medoid)	12.3516	9.79629	22.125	121
cluster_5.pdb ( medoid)	7.64716	17.2613	48.3191	132
cluster_6.pdb ( medoid)	7.39601	5.54353	13.7434	41
cluster_7.pdb ( medoid)	6.9756	7.02448	21.6936	49
cluster_8.pdb ( medoid)	6.78917	16.055	40.3636	109
cluster_9.pdb ( medoid)	6.54279	17.4238	41.3299	114
cluster_10.pdb ( medoid)	3.89978	18.2062	43.9153	71