Project name: 6d4ed4ce4ab6d8b

Status: done

submitted: 2026-02-19 16:20:35, status changed: 2026-02-19 20:55:48

Project settings
Protein sequence(s) DWVIPPISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTSVMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPTYTLVVQAADLQGEGLSTTATAVITVTDTNDNPPIF input pdb
Peptide sequence DWVIPP
Simulation mc cycles50
Peptide secondary structure psipred CCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 39.566 3.4373 28.5403 136
cluster_2.pdb ( medoid) 29.7352 5.9189 17.3235 176
cluster_3.pdb ( medoid) 23.073 4.72414 37.573 109
cluster_4.pdb ( medoid) 20.6213 5.86772 17.0992 121
cluster_5.pdb ( medoid) 19.5697 5.00774 23.2566 98
cluster_6.pdb ( medoid) 17.9976 6.94538 17.6511 125
cluster_7.pdb ( medoid) 10.9592 8.94223 29.4023 98
cluster_8.pdb ( medoid) 7.99345 9.00738 23.6233 72
cluster_9.pdb ( medoid) 7.26363 6.88361 29.2195 50
cluster_10.pdb ( medoid) 1.66309 9.01933 20.3435 15