CABS-dock: 6d9a7b5b763d68b

Project name: 6d9a7b5b763d68b

Status: done

submitted: 2026-06-02 11:58:57, status changed: 2026-06-02 13:43:54

Project settings

Protein sequence(s)	DHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI input pdb
Peptide sequence	QWQGGGGSGWEQGGG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	40.022	4.12273	13.3148	165
cluster_2.pdb ( medoid)	18.0135	7.66091	23.553	138
cluster_3.pdb ( medoid)	17.3637	5.2984	13.0597	92
cluster_4.pdb ( medoid)	16.3689	6.90335	15.1405	113
cluster_5.pdb ( medoid)	15.7523	7.99882	21.2814	126
cluster_6.pdb ( medoid)	11.1041	9.546	31.8369	106
cluster_7.pdb ( medoid)	8.58578	8.73537	22.4801	75
cluster_8.pdb ( medoid)	8.26745	5.32208	22.0747	44
cluster_9.pdb ( medoid)	7.25734	8.54307	37.2141	62
cluster_10.pdb ( medoid)	6.91853	11.4186	28.1051	79