Project name: 7T5M_QAIELQ_E2

Status: done

submitted: 2026-05-30 16:09:14, status changed: 2026-05-31 14:54:23

Project settings
Protein sequence(s) GSSHSSMMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRRFDSDAASQRMEEPRAPWIEQEGPPEYWDGETRRKVKAHSQTHRVDLGTLLRGYYNQSEAGSHTVQRMYGCDVVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHHHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKKETLQRTTDAPKKTHMMTHHAVSDHEATLRCWALSFYPPAEITLTWQRDGEDDQTQDTELVETRPAGDGTFQKWAAVVVPSSSGQEQRYTCHVQHEGLPKPLTLRWEP input pdb
Peptide sequence QAIELQLTLETIYNSQYSN
Simulation mc cycles200
Peptide secondary structure psipred CCEEEEEEHHHHHHCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 56.0087 5.37417 17.3938 301
cluster_2.pdb ( medoid) 41.8346 2.6055 14.4323 109
cluster_3.pdb ( medoid) 27.0782 4.65319 9.3992 126
cluster_4.pdb ( medoid) 20.743 3.08538 6.52193 64
cluster_5.pdb ( medoid) 11.5707 11.1488 31.2769 129
cluster_6.pdb ( medoid) 8.70472 8.1565 29.0893 71
cluster_7.pdb ( medoid) 8.47239 5.19334 12.0026 44
cluster_8.pdb ( medoid) 7.7858 5.266 14.4947 41
cluster_9.pdb ( medoid) 7.30438 10.9523 21.271 80
cluster_10.pdb ( medoid) 4.67117 7.49277 15.4702 35