CABS-dock: 6df7e1c6fa6c335

Project name: 6df7e1c6fa6c335

Status: done

submitted: 2025-12-29 08:47:33, status changed: 2025-12-29 12:43:14

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATRVIVQCGSNCFRMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	LPPTDESIKYTIYNSTGIQIGAYNYMEIGG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCEEEECCCCEEECCCCEECCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.5971	8.76481	32.7306	163
cluster_2.pdb ( medoid)	14.6932	9.11988	30.7034	134
cluster_3.pdb ( medoid)	14.0942	9.64936	29.9382	136
cluster_4.pdb ( medoid)	11.8812	9.17415	23.8055	109
cluster_5.pdb ( medoid)	10.3879	13.5735	30.7303	141
cluster_6.pdb ( medoid)	9.45844	11.1012	27.3085	105
cluster_7.pdb ( medoid)	6.52216	14.1058	27.1937	92
cluster_8.pdb ( medoid)	4.77533	8.7952	26.3068	42
cluster_9.pdb ( medoid)	2.90141	12.0631	30.413	35
cluster_10.pdb ( medoid)	2.89331	14.8619	31.0682	43