Project name: primed p22

Status: done

submitted: 2025-05-09 14:46:52, status changed: 2025-05-09 20:13:00

Project settings
Protein sequence(s) TPIATFVSGSPSLNTYNATTVNSSANAFSCAYYLQQWNIQGLLVTSLYLKLDSATMGNRPGDLNSANAKWFTFWVSAYLQQCNPSGIQAGTVSPSTATLTDFEPMANRSVTSPWTYSANGYYEPSIGEFQVFSPVVTGAWNPGNIGIRVLPVPVSASGERYTLLCYSLQCTNASIFNPNNSGTMIVGPVLYSCPAASLP input pdb
Peptide sequence QWKAFG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 36.4639 4.85412 13.6403 177
cluster_2.pdb ( medoid) 27.1969 3.34597 13.0367 91
cluster_3.pdb ( medoid) 18.437 5.5866 19.1531 103
cluster_4.pdb ( medoid) 15.2477 5.90251 16.9321 90
cluster_5.pdb ( medoid) 15.1229 12.0347 39.388 182
cluster_6.pdb ( medoid) 11.0395 6.43142 16.0244 71
cluster_7.pdb ( medoid) 10.97 7.29259 23.4145 80
cluster_8.pdb ( medoid) 10.0439 9.558 29.2111 96
cluster_9.pdb ( medoid) 6.78347 8.40278 25.3413 57
cluster_10.pdb ( medoid) 4.69786 11.2817 33.0575 53