Project name: 6ea47a9131e3151

Status: done

submitted: 2026-07-22 21:58:48, status changed: 2026-07-23 04:33:10

Project settings
Protein sequence(s) PPCTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCTLLGKLEAHQGTTESDVVCSSSMTLTQERHYEHLGRCCSRCEPGKYLSSKCTPTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDAGKALVAVDPGNHTAPRRCACTAGYHWNSDCECCRRNTECAPGFGAQHPLQLNKDTVCTPCLLGFFSDVFSSTDKCKPWTNCQGTTESDVV input pdb
Peptide sequence NVLKLSSGE
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 29.2947 6.92958 25.3466 203
cluster_2.pdb ( medoid) 28.2199 3.75622 19.2522 106
cluster_3.pdb ( medoid) 25.8226 5.61523 20.0233 145
cluster_4.pdb ( medoid) 22.3658 6.66196 26.1209 149
cluster_5.pdb ( medoid) 9.27018 9.9243 28.4171 92
cluster_6.pdb ( medoid) 8.07874 11.7593 25.6941 95
cluster_7.pdb ( medoid) 5.77578 10.2151 32.1289 59
cluster_8.pdb ( medoid) 5.59123 9.65798 22.8486 54
cluster_9.pdb ( medoid) 4.58976 12.2011 30.2667 56
cluster_10.pdb ( medoid) 3.7842 10.8345 36.9102 41