Project name: 7044b48c1149e9f

Status: done

submitted: 2025-04-22 12:15:26, status changed: 2025-04-22 18:23:24

Project settings
Protein sequence(s) AESQPDPMPDDLHKSSEFTGTMGNMKYLYDDHYVSATKVKSVDSFFKWDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKGGKTCMYGGITKHEGNHFDNGNLQNVLVRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKNG input pdb
Peptide sequence NDEFLLGYEVNPDSG
Simulation mc cycles50
Peptide secondary structure psipred CCCEECCEEECCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 26.3501 4.85767 29.2176 128
cluster_2.pdb ( medoid) 20.6265 6.88435 23.5877 142
cluster_3.pdb ( medoid) 15.4889 8.26399 34.8823 128
cluster_4.pdb ( medoid) 13.9457 12.6921 37.1426 177
cluster_5.pdb ( medoid) 12.8257 8.10875 21.7424 104
cluster_6.pdb ( medoid) 9.6402 9.54337 27.9405 92
cluster_7.pdb ( medoid) 8.25042 10.3025 30.5792 85
cluster_8.pdb ( medoid) 5.30616 8.48071 29.5561 45
cluster_9.pdb ( medoid) 5.21841 7.85679 17.2491 41
cluster_10.pdb ( medoid) 4.4095 13.1534 31.5483 58