Project name: 70765449e96a359

Status: done

submitted: 2026-01-21 11:01:13, status changed: 2026-01-21 13:10:01

Project settings
Protein sequence(s) GTVFTTVEDLLGSKILLTCSLDDSTEVTGHRWLKGGVVLKEDALPGQKTEFKVDSSDDQWGEYSCVFLPEPMGTANIQLHG input pdb
Peptide sequence RSLANDWQSSNLTGT
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHHHCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 31.2973 3.93006 26.4385 123
cluster_2.pdb ( medoid) 20.0239 5.4435 11.3401 109
cluster_3.pdb ( medoid) 19.0072 7.2078 16.2851 137
cluster_4.pdb ( medoid) 18.4698 7.9048 22.8376 146
cluster_5.pdb ( medoid) 17.5192 6.96379 17.9248 122
cluster_6.pdb ( medoid) 13.367 9.35142 16.8266 125
cluster_7.pdb ( medoid) 9.9094 7.46766 18.6413 74
cluster_8.pdb ( medoid) 9.06028 5.73934 12.2671 52
cluster_9.pdb ( medoid) 6.71071 10.8781 25.8421 73
cluster_10.pdb ( medoid) 6.25912 6.23091 12.835 39