CABS-dock: 712cad2e0ec14ee

Project name: 712cad2e0ec14ee

Status: done

submitted: 2025-03-10 00:17:30, status changed: 2025-03-10 06:56:43

Project settings

Protein sequence(s)	MTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTASAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK input pdb
Peptide sequence	RRPLYISYDPVRR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	30.4799	3.80578	30.8724	116
cluster_2.pdb ( medoid)	26.0002	4.61535	23.992	120
cluster_3.pdb ( medoid)	18.2114	6.53436	32.7888	119
cluster_4.pdb ( medoid)	12.1252	12.9482	32.8698	157
cluster_5.pdb ( medoid)	10.4478	11.8686	25.7416	124
cluster_6.pdb ( medoid)	8.29176	12.6632	42.1649	105
cluster_7.pdb ( medoid)	7.78764	8.34656	31.0365	65
cluster_8.pdb ( medoid)	5.1383	16.737	32.9533	86
cluster_9.pdb ( medoid)	5.09525	14.7196	29.567	75
cluster_10.pdb ( medoid)	2.44405	13.5022	30.3091	33