CABS-dock: CDK5-DRP1-12

Project name: CDK5-DRP1-12

Status: done

submitted: 2026-06-23 08:42:16, status changed: 2026-06-24 06:56:52

Project settings

Protein sequence(s)

QKYEKLEKIYGTVFKAKNRETHEIVALKRVRLDGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAARPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSSTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNES input pdb

Peptide sequence

PIMPASPQK

Simulation mc cycles

100

Peptide secondary structure psipred

CCCCCCCCC

Flexible regions

132:A - 139:A

25:A - 31:A

Unlikely to bind regions

1:B - 147:B

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	35.1347	4.49698	22.8092	158
cluster_2.pdb ( medoid)	33.7842	4.52875	11.4877	153
cluster_3.pdb ( medoid)	31.1576	3.7872	9.81406	118
cluster_4.pdb ( medoid)	25.317	3.31793	7.05328	84
cluster_5.pdb ( medoid)	25.0896	2.43128	5.01475	61
cluster_6.pdb ( medoid)	22.2337	4.54265	21.3105	101
cluster_7.pdb ( medoid)	17.112	4.85039	14.3411	83
cluster_8.pdb ( medoid)	12.8989	3.10103	13.997	40
cluster_9.pdb ( medoid)	12.6147	9.43345	23.1751	119
cluster_10.pdb ( medoid)	12.1699	6.82009	13.2448	83