Project name: CDK5-DRP1-12

Status: done

submitted: 2026-06-23 08:42:16, status changed: 2026-06-24 06:56:52

Project settings
Protein sequence(s) QKYEKLEKIYGTVFKAKNRETHEIVALKRVRLDGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAARPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSSTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNES input pdb
Peptide sequence PIMPASPQK
Simulation mc cycles100
Peptide secondary structure psipred CCCCCCCCC
Flexible regions
132:A - 139:A 25:A - 31:A
Unlikely to bind regions
1:B - 147:B
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 35.1347 4.49698 22.8092 158
cluster_2.pdb ( medoid) 33.7842 4.52875 11.4877 153
cluster_3.pdb ( medoid) 31.1576 3.7872 9.81406 118
cluster_4.pdb ( medoid) 25.317 3.31793 7.05328 84
cluster_5.pdb ( medoid) 25.0896 2.43128 5.01475 61
cluster_6.pdb ( medoid) 22.2337 4.54265 21.3105 101
cluster_7.pdb ( medoid) 17.112 4.85039 14.3411 83
cluster_8.pdb ( medoid) 12.8989 3.10103 13.997 40
cluster_9.pdb ( medoid) 12.6147 9.43345 23.1751 119
cluster_10.pdb ( medoid) 12.1699 6.82009 13.2448 83