Project name: akbb

Status: done

submitted: 2026-03-15 05:42:03, status changed: 2026-03-15 20:31:42

Project settings
Protein sequence(s) SIGFIDRQLGTNPAELPPLPYGYDALEKAIDAETMKLHHDKHHAAYVNNLNNALKKHPELQNSSVEALLRDLNSVPEDIRTTVRNNGGGHLNHTIFWQIMSPDGGGQPTGDIAQEINQTFGSFEEFKKQFNQAGGDRFGSGWVWLVRNPQGQLQVVSTPNQDNPIMEGSYPIMGNDVWEHAYYLRYQNRRPEYLNNWWNVVNWSEINRRTQASSIGFIDRQLGTNPAELPPLPYGYDALEKAIDAETMKLHHDKHHAAYVNNLNNALKKHPELQNSSVEALLRDLNSVPEDIRTTVRNNGGGHLNHTIFWQIMSPDGGGQPTGDIAQEINQTFGSFEEFKKQFNQAGGDRFGSGWVWLVRNPQGQLQVVSTPNQDNPIMEGSYPIMGNDVWEHAYYLRYQNRRPEYLNNWWNVVNWSEINRRTQAS input pdb
Peptide sequence AEPEQ
Simulation mc cycles50
Peptide secondary structure CCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 66.5122 2.08984 33.2312 139
cluster_2.pdb ( medoid) 44.5621 4.12907 26.2591 184
cluster_3.pdb ( medoid) 20.3957 6.07971 31.0055 124
cluster_4.pdb ( medoid) 18.9794 3.7409 33.5609 71
cluster_5.pdb ( medoid) 14.7894 8.92529 28.6569 132
cluster_6.pdb ( medoid) 14.2268 10.684 38.5949 152
cluster_7.pdb ( medoid) 9.74868 5.84695 21.0216 57
cluster_8.pdb ( medoid) 5.84967 10.9408 36.2453 64
cluster_9.pdb ( medoid) 4.32799 8.78005 29.1994 38
cluster_10.pdb ( medoid) 2.81248 13.8668 30.7547 39