Project name: 1n0a

Status: done

submitted: 2025-12-12 14:01:59, status changed: 2025-12-12 17:25:39

Project settings
Protein sequence(s) SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence CTWEPDGKLTC
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 30.9114 3.68796 19.3027 114
cluster_2.pdb ( medoid) 22.33 7.07569 24.7417 158
cluster_3.pdb ( medoid) 22.0219 10.3533 27.4161 228
cluster_4.pdb ( medoid) 20.8644 6.80585 20.7095 142
cluster_5.pdb ( medoid) 9.82186 8.34873 20.8712 82
cluster_6.pdb ( medoid) 7.59267 7.50725 23.667 57
cluster_7.pdb ( medoid) 6.94127 11.2371 22.0888 78
cluster_8.pdb ( medoid) 6.69596 7.91522 16.8659 53
cluster_9.pdb ( medoid) 6.31433 7.60175 14.4671 48
cluster_10.pdb ( medoid) 4.28167 9.34215 24.9677 40