CABS-dock: MHC2+OmpU14

Project name: MHC2+OmpU14

Status: done

submitted: 2025-12-30 09:20:53, status changed: 2025-12-30 18:06:30

Project settings

Protein sequence(s)	HAIKDHVISQFGAGDAFTDGELQSVGELMLADANQDDDWFELKMMEEFRAVDQDPYFVTPSVFCNTDETCQNVAHIFIDNGEFIQPTVKVAPPESRISNSNTITLMCLVTGFFPPEISITWFKNGQELTEGSTYTTNSVDEPADLFYDCKVNHQGTYEPMGLTVEEPGVQHFVHQFMYGEGSEVFDFDSDEYFYVDKRELGRPDAWVNGEVVPAELRSIQPAEHWDRNQLLEECRAHNGTLESVRVLLDRYYWNSQKESILRTRAVTMSCRHNYEIFVPPTVKVFPKPSIEKNGNVTLICLVTGFYPKHIEVKWLLNGQELPAQVGYYVNGSELQFQDALDDICPTVEKSGLYSCRVEHSGVFEPIGLEWEH input pdb
Peptide sequence	FTAYELVASYKIASK
Simulation mc cycles	50
Peptide secondary structure psipred	CCHHHHHHHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	65.0388	1.53754	2.7946	100
cluster_2.pdb ( medoid)	30.6244	4.08171	12.3323	125
cluster_3.pdb ( medoid)	27.6689	4.87912	13.7401	135
cluster_4.pdb ( medoid)	22.9189	6.10849	13.0343	140
cluster_5.pdb ( medoid)	19.3759	6.81258	19.9022	132
cluster_6.pdb ( medoid)	14.9492	6.62242	13.1004	99
cluster_7.pdb ( medoid)	11.973	5.01128	9.95178	60
cluster_8.pdb ( medoid)	11.2936	8.50041	20.1188	96
cluster_9.pdb ( medoid)	7.27039	9.90318	21.7593	72
cluster_10.pdb ( medoid)	5.95975	6.87948	12.9979	41