CABS-dock: 734031e2f253cca

Project name: 734031e2f253cca

Status: done

submitted: 2026-01-16 10:38:13, status changed: 2026-01-16 19:01:52

Project settings

Protein sequence(s)	VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence	RVIVQFVGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEECCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	35.0978	3.10561	28.0319	109
cluster_2.pdb ( medoid)	18.4436	7.64494	26.0582	141
cluster_3.pdb ( medoid)	18.2016	12.5264	31.9932	228
cluster_4.pdb ( medoid)	16.0368	6.54744	19.7833	105
cluster_5.pdb ( medoid)	9.69293	9.28512	39.5624	90
cluster_6.pdb ( medoid)	8.43824	14.932	49.8489	126
cluster_7.pdb ( medoid)	5.1106	12.523	42.2159	64
cluster_8.pdb ( medoid)	3.61087	17.7243	34.6397	64
cluster_9.pdb ( medoid)	2.07674	18.7794	50.0877	39
cluster_10.pdb ( medoid)	1.50377	22.6098	50.1542	34