Project name: 738967f0650cd5a

Status: done

submitted: 2026-04-10 04:39:01, status changed: 2026-04-11 02:51:28

Project settings
Protein sequence(s) TFQERLLAFERKHVITPEAHVTLAKQLAGDIALELQAYLRSKFPELPFGALVPGGPLYDGLQAGTAEHVRLLAPLELEPGLWSLVPGVDTVAAEPRCWAVRRTQLEFHPRGCSPWDRFLVGGYLSSRVLLELLRKALSASVNWPAIGSLLGCLIWPDVASEELLLKVQHECLEFTLAVLMVVPGASTDDRLLLAWPLEGLASNLWLQDLYPVETARLRALDDQDAGTRRRLLLLLCGICRGHPALVRLGWSHLTQVVLHLGEEEVAWTEEALGERFLQALEFLVGSLEQASLPCHFNPSVNLLGNFREEEIDDIGYVLYSGLQVPESLFTFQERLLAFERKHVITPEAHVTLAKQLAGDIALELQAYLRSKFPELPFGALVPGGPLYDGLQAGTAEHVRLLAPLELEPGLWSLVPGVDTVAAEPRCWAVRRTQLEFHPRGCSPWDRFLVGGYLSSRVLLELLRKALSASVNWPAIGSLLGCLIWPDVASEELLLKVQHECLEFTLAVLMVVPGASTDDRLLLAWPLEGLASNLWLQDLYPVETARLRALDDQDAGTRRRLLLLLCGICRGHPALVRLGWSHLTQVVLHLGEEEVAWTEEALGERFLQALEFLVGSLEQASLPCHFNPSVNLLGNFREEEIDDIGYVLYSGLQVPESLF input pdb
Peptide sequence NLKDTMTKRY
Simulation mc cycles50
Peptide secondary structure psipred CHHHCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 21.9766 4.86881 50.456 107
cluster_2.pdb ( medoid) 18.1827 9.29453 79.3643 169
cluster_3.pdb ( medoid) 12.0794 5.0499 12.5435 61
cluster_4.pdb ( medoid) 9.92016 3.93139 5.91371 39
cluster_5.pdb ( medoid) 6.50707 10.1428 21.0678 66
cluster_6.pdb ( medoid) 5.7429 11.4925 30.8992 66
cluster_7.pdb ( medoid) 2.1351 14.9876 41.8942 32
cluster_8.pdb ( medoid) 2.12387 13.1835 24.1246 28
cluster_9.pdb ( medoid) 0.542896 9.20987 12.4231 5
cluster_10.pdb ( medoid) 0.37355 18.7391 29.6664 7