CABS-dock: 73ab6c29b7d5fa0

Project name: 73ab6c29b7d5fa0

Status: done

submitted: 2026-01-20 05:55:11, status changed: 2026-01-20 09:12:36

Project settings

Protein sequence(s)	MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATLPPTDESIKYTIYNSTGIQIGAYNYMEIGGMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence	RVIFVQVGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	23.1149	5.58081	23.9162	129
cluster_2.pdb ( medoid)	19.9012	6.63275	21.6261	132
cluster_3.pdb ( medoid)	19.5231	5.63435	22.8728	110
cluster_4.pdb ( medoid)	15.1798	7.57586	23.6707	115
cluster_5.pdb ( medoid)	14.4377	7.68821	25.7798	111
cluster_6.pdb ( medoid)	11.9348	10.1384	22.2097	121
cluster_7.pdb ( medoid)	10.1492	11.2324	25.8555	114
cluster_8.pdb ( medoid)	9.92955	5.3376	10.405	53
cluster_9.pdb ( medoid)	7.61134	9.32819	22.5946	71
cluster_10.pdb ( medoid)	5.9676	7.37315	18.7032	44