CABS-dock: 7420928c3e8cd8f

Project name: 7420928c3e8cd8f

Status: done

submitted: 2026-04-14 05:17:46, status changed: 2026-04-14 10:37:10

Project settings

Protein sequence(s)	MLCATLPESRDVRTLIETFRQAALQIGYQHHAIVELSGTSHPASIDVVSLHYPSEWVEHYTRNDYFTIDPVHRAAFRYSTPFPWNDIATSNLRERHLLMEAEDAGLDNGISIPLHQPLGRVLLVSLSGTAPTHDADAKWRNAYLLGMQFNLQLQSMRTCRPIPPSVHLTDREQMCLTWVARGKSSWVIANMLDISKYTVDFHIENAMEKLNTRSRTFAAVKATRQGLIFP input pdb
Peptide sequence	VVIPIELR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	21.3925	5.93666	16.5094	127
cluster_2.pdb ( medoid)	19.6269	5.0441	11.7302	99
cluster_3.pdb ( medoid)	17.1332	7.82105	17.7782	134
cluster_4.pdb ( medoid)	16.5488	7.85556	42.5846	130
cluster_5.pdb ( medoid)	15.7493	9.14328	29.5727	144
cluster_6.pdb ( medoid)	13.6382	7.8456	46.2671	107
cluster_7.pdb ( medoid)	9.66844	9.41207	25.7641	91
cluster_8.pdb ( medoid)	4.95677	8.47326	17.7826	42
cluster_9.pdb ( medoid)	3.38144	14.4909	37.3019	49
cluster_10.pdb ( medoid)	2.54967	14.5117	38.163	37