Project name: 744b9292fa80949

Status: done

submitted: 2025-12-29 11:02:57, status changed: 2025-12-29 14:04:30

Project settings
Protein sequence(s) MVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGATMVLSSDPPGPAAYRISDSSFVQCGSNCSMIIDGDVARGHLRDLEGAT input pdb
Peptide sequence LPPTDESIKYTIYNSTGIQIGAYNYMEIGG
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCCEEEECCCCEEECCCCEECCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 33.3808 3.17548 26.0521 106
cluster_2.pdb ( medoid) 29.5692 6.72997 19.0029 199
cluster_3.pdb ( medoid) 18.3491 9.70076 22.1065 178
cluster_4.pdb ( medoid) 11.5157 10.8548 27.9908 125
cluster_5.pdb ( medoid) 8.93768 7.94389 25.9053 71
cluster_6.pdb ( medoid) 6.73176 10.6956 26.0254 72
cluster_7.pdb ( medoid) 6.68687 13.0106 26.2535 87
cluster_8.pdb ( medoid) 5.34965 10.0941 32.3805 54
cluster_9.pdb ( medoid) 4.68911 13.8619 29.2935 65
cluster_10.pdb ( medoid) 3.98218 10.7981 22.4317 43