CABS-dock: 74fef542c1ee9e3

Project name: 74fef542c1ee9e3

Status: done

submitted: 2026-01-20 07:42:59, status changed: 2026-01-20 13:39:51

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	RVIVFQVGSNCR
Simulation mc cycles	50
Peptide secondary structure psipred	CEEEEEECCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.0611	6.92882	38.7404	139
cluster_2.pdb ( medoid)	19.9512	6.66627	33.1528	133
cluster_3.pdb ( medoid)	16.1045	6.8304	23.0476	110
cluster_4.pdb ( medoid)	9.78596	12.3647	43.0989	121
cluster_5.pdb ( medoid)	9.36843	10.2472	29.9794	96
cluster_6.pdb ( medoid)	7.10532	13.0888	32.473	93
cluster_7.pdb ( medoid)	5.80708	14.6373	31.2423	85
cluster_8.pdb ( medoid)	5.67884	14.6157	29.0339	83
cluster_9.pdb ( medoid)	4.69142	15.5603	35.8561	73
cluster_10.pdb ( medoid)	4.55107	14.7218	34.5974	67