CABS-dock: 2mz6

Project name: 2mz6

Status: done

submitted: 2025-12-12 16:09:50, status changed: 2025-12-12 19:42:51

Project settings

Protein sequence(s)	SSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHK input pdb
Peptide sequence	RGGGLCYCRRRFCVCVGR
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEEEECCEEEEEECC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.9059	6.50591	27.9516	123
cluster_2.pdb ( medoid)	18.4743	4.54685	22.0608	84
cluster_3.pdb ( medoid)	14.9488	8.02742	26.8038	120
cluster_4.pdb ( medoid)	14.5105	11.0265	36.0657	160
cluster_5.pdb ( medoid)	11.6007	10.5166	29.5427	122
cluster_6.pdb ( medoid)	8.0145	13.7251	38.2196	110
cluster_7.pdb ( medoid)	7.01892	9.97305	22.841	70
cluster_8.pdb ( medoid)	6.67397	12.2865	26.333	82
cluster_9.pdb ( medoid)	6.56203	5.02893	10.3991	33
cluster_10.pdb ( medoid)	5.03308	19.0738	41.9363	96