CABS-dock: 75a86cb017674ba

Project name: 75a86cb017674ba

Status: done

submitted: 2026-01-21 16:26:45, status changed: 2026-01-21 19:40:36

Project settings

Protein sequence(s)	AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVI input pdb
Peptide sequence	GAFSRAT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	53.892	3.15445	11.7042	170
cluster_2.pdb ( medoid)	51.8354	2.52723	14.6579	131
cluster_3.pdb ( medoid)	21.9378	4.33043	21.8373	95
cluster_4.pdb ( medoid)	21.1137	4.97306	26.1743	105
cluster_5.pdb ( medoid)	20.7227	8.49311	33.3107	176
cluster_6.pdb ( medoid)	18.6091	6.82461	25.3244	127
cluster_7.pdb ( medoid)	6.83045	8.19859	17.4941	56
cluster_8.pdb ( medoid)	5.03113	9.93812	25.6212	50
cluster_9.pdb ( medoid)	3.85739	15.0361	31.5176	58
cluster_10.pdb ( medoid)	1.92411	16.6311	36.0115	32