CABS-dock: 75cb7b4ed0c978b

Project name: 75cb7b4ed0c978b

Status: done

submitted: 2026-03-08 14:25:07, status changed: 2026-03-08 20:36:46

Project settings

Protein sequence(s)	VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence	VQLFGSNCW
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.5234	6.72402	34.2053	138
cluster_2.pdb ( medoid)	20.1432	7.94312	25.4365	160
cluster_3.pdb ( medoid)	15.5214	9.59963	58.3329	149
cluster_4.pdb ( medoid)	7.71013	11.5433	25.0087	89
cluster_5.pdb ( medoid)	7.65031	12.6792	42.1382	97
cluster_6.pdb ( medoid)	6.53313	10.4085	21.6883	68
cluster_7.pdb ( medoid)	6.31767	11.3966	30.4678	72
cluster_8.pdb ( medoid)	5.89654	16.1111	47.3759	95
cluster_9.pdb ( medoid)	4.20292	16.4171	43.8274	69
cluster_10.pdb ( medoid)	4.19954	15.0016	37.2736	63