Project name: 75cb7b4ed0c978b

Status: done

submitted: 2026-03-08 14:25:07, status changed: 2026-03-08 20:36:46

Project settings
Protein sequence(s) VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSSVPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPGPRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLAPSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK input pdb
Peptide sequence VQLFGSNCW
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.5234 6.72402 34.2053 138
cluster_2.pdb ( medoid) 20.1432 7.94312 25.4365 160
cluster_3.pdb ( medoid) 15.5214 9.59963 58.3329 149
cluster_4.pdb ( medoid) 7.71013 11.5433 25.0087 89
cluster_5.pdb ( medoid) 7.65031 12.6792 42.1382 97
cluster_6.pdb ( medoid) 6.53313 10.4085 21.6883 68
cluster_7.pdb ( medoid) 6.31767 11.3966 30.4678 72
cluster_8.pdb ( medoid) 5.89654 16.1111 47.3759 95
cluster_9.pdb ( medoid) 4.20292 16.4171 43.8274 69
cluster_10.pdb ( medoid) 4.19954 15.0016 37.2736 63