Project name: EPFWPGLFA_ıl6

Status: done

submitted: 2025-03-09 19:13:34, status changed: 2025-03-09 22:48:26

Project settings
Protein sequence(s) MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM input pdb
Peptide sequence EPFWPGLFA
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 34.4503 3.33814 23.0966 115
cluster_2.pdb ( medoid) 21.0199 7.61185 27.1754 160
cluster_3.pdb ( medoid) 14.1665 7.12952 18.5134 101
cluster_4.pdb ( medoid) 12.7968 9.45546 28.2217 121
cluster_5.pdb ( medoid) 10.5978 9.62467 34.0859 102
cluster_6.pdb ( medoid) 10.3113 8.34035 22.8603 86
cluster_7.pdb ( medoid) 9.56763 12.7513 49.1901 122
cluster_8.pdb ( medoid) 8.06469 8.80381 18.5174 71
cluster_9.pdb ( medoid) 7.25406 8.82264 25.3709 64
cluster_10.pdb ( medoid) 5.95382 9.74165 47.408 58