Project name: 76490ec5746afec

Status: done

submitted: 2025-08-24 16:12:03, status changed: 2025-08-24 19:21:12

Project settings
Protein sequence(s) SGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTIKP input pdb
Peptide sequence NDIEYNPSIWRSNHGARQLY
Simulation mc cycles50
Peptide secondary structure psipred CCCCCCHHHHCCCCCCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 36.7025 2.94258 22.2096 108
cluster_2.pdb ( medoid) 35.092 2.90664 14.3789 102
cluster_3.pdb ( medoid) 16.8125 6.30482 21.4722 106
cluster_4.pdb ( medoid) 15.8204 6.63699 34.4357 105
cluster_5.pdb ( medoid) 14.8976 7.38373 28.5882 110
cluster_6.pdb ( medoid) 11.2837 11.7869 24.8195 133
cluster_7.pdb ( medoid) 6.77026 15.3613 33.1535 104
cluster_8.pdb ( medoid) 6.31694 13.9308 29.7083 88
cluster_9.pdb ( medoid) 4.4222 13.794 37.4865 61
cluster_10.pdb ( medoid) 4.28069 19.3894 39.4402 83