CABS-dock: 76490ec5746afec

Project name: 76490ec5746afec

Status: done

submitted: 2025-08-24 16:12:03, status changed: 2025-08-24 19:21:12

Project settings

Protein sequence(s)	SGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNSQVIGASVDSHFEHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVSPAGWKPGSDTIKP input pdb
Peptide sequence	NDIEYNPSIWRSNHGARQLY
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCHHHHCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	36.7025	2.94258	22.2096	108
cluster_2.pdb ( medoid)	35.092	2.90664	14.3789	102
cluster_3.pdb ( medoid)	16.8125	6.30482	21.4722	106
cluster_4.pdb ( medoid)	15.8204	6.63699	34.4357	105
cluster_5.pdb ( medoid)	14.8976	7.38373	28.5882	110
cluster_6.pdb ( medoid)	11.2837	11.7869	24.8195	133
cluster_7.pdb ( medoid)	6.77026	15.3613	33.1535	104
cluster_8.pdb ( medoid)	6.31694	13.9308	29.7083	88
cluster_9.pdb ( medoid)	4.4222	13.794	37.4865	61
cluster_10.pdb ( medoid)	4.28069	19.3894	39.4402	83