Project name: K22222

Status: done

submitted: 2026-07-01 13:38:23, status changed: 2026-07-01 22:57:06

Project settings
Protein sequence(s) ATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF input pdb
Peptide sequence QKATLLDKVKDLLPE
Simulation mc cycles50
Peptide secondary structure psipred CCCCHHHHHHHHCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.2251 4.95538 19.0886 125
cluster_2.pdb ( medoid) 25.1661 4.60937 11.7301 116
cluster_3.pdb ( medoid) 19.037 6.98638 32.649 133
cluster_4.pdb ( medoid) 18.9608 4.00826 16.2774 76
cluster_5.pdb ( medoid) 17.4374 5.73481 30.7419 100
cluster_6.pdb ( medoid) 10.5735 14.1864 48.4041 150
cluster_7.pdb ( medoid) 10.1932 10.9878 35.0723 112
cluster_8.pdb ( medoid) 6.48894 13.5615 37.5399 88
cluster_9.pdb ( medoid) 3.06968 14.9853 50.5788 46
cluster_10.pdb ( medoid) 2.75881 19.5737 47.6877 54