Project name: 7701ffa36c23324

Status: done

submitted: 2026-01-20 05:17:45, status changed: 2026-01-20 17:43:07

Project settings
Protein sequence(s) VKSLKKEYSNENAVVKRMQSLQLDCVAVPSSRSNSATEQPGSLHSSQGLGMGPVEESWFAPSLEHPQEENEPSLQSKLQDEANYHLYGSRMDRQTKQQPRQNVAYNREEERRRRVSHDPFAQQRPYENFQNTEGKGTAYSSAASHGNAVHQPSGLTSQPQVLYQNNGLYSSHGFGTRPLDPGTAGPRVWYRPIPSHMPSLHNIPVPETNYLGNTPTMPFSSLPPTDESIKYTIYNSTGIQIGAYNYMEIGGTSSSLLDSTNTNFKEEPAAKYQAIFDNTTSLTDKHLDPIRENLGKHWKNCARKLGFTQSQIDEIDHDYERDGLKEKVYQMLQKWVMREGIKGATVGKLAQALHQCSRIDLLSSLIYVSQN input pdb
Peptide sequence RVIFVQCGSNCR
Simulation mc cycles50
Peptide secondary structure psipred CEEEEECCCCCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 20.7618 5.92433 42.0798 123
cluster_2.pdb ( medoid) 20.3154 6.25142 19.8761 127
cluster_3.pdb ( medoid) 15.3111 8.49059 47.1363 130
cluster_4.pdb ( medoid) 14.1272 10.0515 34.7539 142
cluster_5.pdb ( medoid) 9.09146 11.3293 29.6776 103
cluster_6.pdb ( medoid) 8.73211 11.7955 31.3236 103
cluster_7.pdb ( medoid) 7.71488 12.962 32.2878 100
cluster_8.pdb ( medoid) 3.11653 21.1774 43.7613 66
cluster_9.pdb ( medoid) 2.98285 22.1265 50.5773 66
cluster_10.pdb ( medoid) 2.14387 18.6578 52.9917 40