CABS-dock: 251229 IgV_Only

Project name: 251229 IgV_Only_3

Status: done

submitted: 2025-12-29 08:38:16, status changed: 2025-12-29 11:43:37

Project settings

Protein sequence(s)	AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNA input pdb
Peptide sequence	WHRSYYTWNLNT
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCEECEECCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	34.7817	3.39259	15.8215	118
cluster_2.pdb ( medoid)	26.9995	5.00008	14.7201	135
cluster_3.pdb ( medoid)	21.8537	7.45869	23.2753	163
cluster_4.pdb ( medoid)	15.4899	6.77859	21.3123	105
cluster_5.pdb ( medoid)	13.5746	10.4607	23.8491	142
cluster_6.pdb ( medoid)	13.0549	6.89395	15.787	90
cluster_7.pdb ( medoid)	11.4433	6.81622	14.9859	78
cluster_8.pdb ( medoid)	9.59139	7.50674	24.7033	72
cluster_9.pdb ( medoid)	6.3563	9.1248	27.1403	58
cluster_10.pdb ( medoid)	4.15392	9.38872	22.2865	39