CABS-dock: 7736d38704b7d43

Project name: 7736d38704b7d43

Status: done

submitted: 2026-01-22 13:00:13, status changed: 2026-01-22 19:36:12

Project settings

Protein sequence(s)	VYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRPSQPLLPQHSSLETQLFCEEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSS input pdb
Peptide sequence	HANTAEIAESYDNRRL
Simulation mc cycles	50
Peptide secondary structure psipred	CCCHHHHHHHHHCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	66.1737	1.51117	6.90042	100
cluster_2.pdb ( medoid)	36.8759	3.41687	12.4643	126
cluster_3.pdb ( medoid)	26.1036	5.59311	11.8536	146
cluster_4.pdb ( medoid)	17.1903	6.74799	16.7388	116
cluster_5.pdb ( medoid)	16.6398	6.55055	15.7749	109
cluster_6.pdb ( medoid)	16.0507	6.7287	14.4655	108
cluster_7.pdb ( medoid)	13.3106	6.1605	21.5857	82
cluster_8.pdb ( medoid)	13.1793	5.61486	10.8509	74
cluster_9.pdb ( medoid)	6.62487	10.5662	19.2374	70
cluster_10.pdb ( medoid)	5.51945	12.5013	23.6942	69