Project name: TestTIM

Status: done

submitted: 2025-08-24 11:18:06, status changed: 2025-08-24 13:07:01

Project settings
Protein sequence(s) MVKVGGEAGPSVTLPCHYSGAVTSMCWNRGSCSLFTCQNNGIVWTNGTHVTYRKDTRYKLLGDLSRRDVSLTIENNTAVSDSGVYCCRVEHRGWFNDMKITVSLEIVPP input pdb
Peptide sequence LKKWWKKVKGLLGGLLGKVTSVIK
Simulation mc cycles50
Peptide secondary structure psipred CHHHHHHHHHHHHHHHHHHHHHCC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 25.2857 4.38983 35.4946 111
cluster_2.pdb ( medoid) 13.9058 9.70818 27.5103 135
cluster_3.pdb ( medoid) 12.7183 8.72758 29.45 111
cluster_4.pdb ( medoid) 10.1794 8.93965 24.8234 91
cluster_5.pdb ( medoid) 10.1766 13.8553 30.769 141
cluster_6.pdb ( medoid) 9.54604 11.1041 25.0537 106
cluster_7.pdb ( medoid) 8.31523 13.349 26.2436 111
cluster_8.pdb ( medoid) 5.63255 12.2502 35.6663 69
cluster_9.pdb ( medoid) 5.04125 14.8773 36.3781 75
cluster_10.pdb ( medoid) 4.91822 10.1663 24.9589 50