Project name: 77df4ebd6ceee70

Status: done

submitted: 2026-03-14 09:37:43, status changed: 2026-03-14 12:08:17

Project settings
Protein sequence(s) NTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRD input pdb
Peptide sequence FFVLKGADYKRITLKVN
Simulation mc cycles50
Peptide secondary structure psipred CEEEECCCEEEEEEEEC
Re-submit project
Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in 3Dmol (WebGL)
Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).
Representative conformations
model_1 Download
model_2 Download
model_3 Download
model_4 Download
model_5 Download
model_6 Download
model_7 Download
model_8 Download
model_9 Download
model_10 Download
 

Download all files
Click the "View" button to load the contact map of appropriate model.
Representative conformations
model_1 View
model_2 View
model_3 View
model_4 View
model_5 View
model_6 View
model_7 View
model_8 View
model_9 View
model_10 View

Receptor residuePeptide residue
Receptor residuePeptide residue
Receptor residuePeptide residue
Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.
Trajectories
replica_1 Download
replica_2 Download
replica_3 Download
replica_4 Download
replica_5 Download
replica_6 Download
replica_7 Download
replica_8 Download
replica_9 Download
replica_10 Download
Selected model: model_1.pdb (most representative model of the best cluster) download the model
Details about clusters
cluster namecluster density average rmsdmax rmsdnumber of elements
cluster_1.pdb ( medoid) 45.748 2.25146 29.862 103
cluster_2.pdb ( medoid) 26.1971 7.55808 27.5579 198
cluster_3.pdb ( medoid) 18.7143 6.83968 25.1575 128
cluster_4.pdb ( medoid) 17.3215 9.46803 31.8763 164
cluster_5.pdb ( medoid) 11.9201 4.78185 19.9333 57
cluster_6.pdb ( medoid) 10.3308 11.9062 32.8873 123
cluster_7.pdb ( medoid) 8.40346 8.92489 24.8322 75
cluster_8.pdb ( medoid) 5.77472 11.4291 25.8445 66
cluster_9.pdb ( medoid) 5.19812 9.81124 26.775 51
cluster_10.pdb ( medoid) 3.34011 10.4787 19.9742 35