CABS-dock: MAD20.2

Project name: MAD20.2_USP7

Status: done

submitted: 2026-01-12 05:28:55, status changed: 2026-01-12 09:26:23

Project settings

Protein sequence(s)	TSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFQKSVGFFLQCNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPEKGFIDDDKVTFEVFVQADAPHGVAWGARAHSS input pdb
Peptide sequence	SSGSVTSGGSVASVASVASGGSGGSVASGG
Simulation mc cycles	50
Peptide secondary structure psipred	CCCCCCCCCCEEEEEEEECCCCCCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	20.4274	5.04225	34.0347	103
cluster_2.pdb ( medoid)	17.5703	7.17117	48.8323	126
cluster_3.pdb ( medoid)	14.9175	8.04425	29.447	120
cluster_4.pdb ( medoid)	14.7608	6.84246	31.2688	101
cluster_5.pdb ( medoid)	11.3407	9.34687	25.5052	106
cluster_6.pdb ( medoid)	10.2639	12.7632	42.5731	131
cluster_7.pdb ( medoid)	8.82527	17.1099	37.5792	151
cluster_8.pdb ( medoid)	3.7809	14.0178	30.1957	53
cluster_9.pdb ( medoid)	3.73881	16.8503	33.2943	63
cluster_10.pdb ( medoid)	3.47846	13.2242	30.7314	46