CABS-dock: 8TBP_YTAVSS

Project name: 8TBP_YTAVSS_E2

Status: done

submitted: 2026-05-30 16:19:53, status changed: 2026-05-31 03:07:43

Project settings

Protein sequence(s)	DTRPRFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAVTELGRPDAEYWNSQKDILEQARAAVDTYCRHNYGVGESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFLNGQEEKAGMVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRA input pdb
Peptide sequence	YTAVSSTWHWTGHNVKH
Simulation mc cycles	200
Peptide secondary structure psipred	CCCCCCEEECCCCCCCC

Re-submit project

Zoom/rotate predicted model of the complex using mouse. Click the "View" button on the right panel to load the appropriate model. View in JSmol (pure html5/js) if you got rendering problems.

Models are ranked and numbered according to their occurrence in docking trajectory (1 = most probable result).

Representative conformations

	model_1		Download
	model_2		Download
	model_3		Download
	model_4		Download
	model_5		Download
	model_6		Download
	model_7		Download
	model_8		Download
	model_9		Download
	model_10		Download

Download all files

Click the "View" button to load the contact map of appropriate model.

Representative conformations

Contact cutoff (Å)

	model_1	View
	model_2	View
	model_3	View
	model_4	View
	model_5	View
	model_6	View
	model_7	View
	model_8	View
	model_9	View
	model_10	View

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Receptor residue	Peptide residue

Select trajectory from the right panel to display animation in JSmol. Note that it may hangs browser window for few minutes or ever.

Trajectories

	replica_1		Download
	replica_2		Download
	replica_3		Download
	replica_4		Download
	replica_5		Download
	replica_6		Download
	replica_7		Download
	replica_8		Download
	replica_9		Download
	replica_10		Download

Selected model: model_1.pdb (most representative model of the best cluster) download the model

Details about clusters

cluster name	cluster density	average rmsd	max rmsd	number of elements
cluster_1.pdb ( medoid)	18.7049	3.84926	17.4676	72
cluster_2.pdb ( medoid)	17.7931	10.9593	37.0234	195
cluster_3.pdb ( medoid)	17.6624	8.66249	45.6769	153
cluster_4.pdb ( medoid)	15.1958	7.10724	31.2517	108
cluster_5.pdb ( medoid)	14.9047	6.44094	16.1597	96
cluster_6.pdb ( medoid)	13.9251	10.5565	33.6771	147
cluster_7.pdb ( medoid)	12.0578	7.29817	36.7121	88
cluster_8.pdb ( medoid)	4.8114	9.14494	20.0754	44
cluster_9.pdb ( medoid)	3.21594	15.5475	46.8784	50
cluster_10.pdb ( medoid)	1.83533	22.8841	50.3413	42